PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013629516.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 346aa    MW: 40252.1 Da    PI: 9.9033
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013629516.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.11.2e-14453148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW+ eEd ll  +v+q+G++ W++++ +m+  ++R +k+c +rw +yl
   XP_013629516.1  4 RQRWSGEEDALLRAYVRQFGPREWHLVSDRMNkpLNRDAKSCLERWKNYL 53
                     89**********************************************97 PP

2Myb_DNA-binding36.51.2e-1159103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
   XP_013629516.1  59 KGSLTEEEQRLVIRLQEKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103
                      6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.287153IPR017930Myb domain
SMARTSM007172.2E-13355IPR001005SANT/Myb domain
SuperFamilySSF466897.7E-22498IPR009057Homeodomain-like
CDDcd001677.23E-8653No hitNo description
Gene3DG3DSA:1.10.10.601.7E-19660IPR009057Homeodomain-like
PfamPF139216.2E-13768No hitNo description
PROSITE profilePS5129423.24854108IPR017930Myb domain
SMARTSM007173.2E-1058106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-1561102IPR009057Homeodomain-like
CDDcd001674.64E-763104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MKERQRWSGE EDALLRAYVR QFGPREWHLV SDRMNKPLNR DAKSCLERWK NYLKPGIKKG  60
SLTEEEQRLV IRLQEKHGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQQRE EKEINKRVEP  120
IDESKYDRIL ESFAEKLVKD RSVSVPMASS NGPPSNHVIP PWLATPNNGN NVAARPPSVT  180
LTLSPSSVAA ASPQPPIPWL QQPERGETHV LGSMIPSCSG GSESVFMSEL MECCRELEEG  240
HRAWAEHKKE AAWRLRRLEL QLESEKTSRQ REKMEEIEAK MKALREEQKM AMEKIEGEYR  300
EQLVGLRRDA EAKEQKLADQ WSSKHIRLTK LLEQHMGCRQ RLLDRP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-157100797MYB PROTO-ONCOGENE PROTEIN
1mse_C4e-15792789C-Myb DNA-Binding Domain
1msf_C4e-15792789C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bol.150771e-155leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT3509821e-178KT350982.1 Brassica napus MYB transcription factor 91-2 (MYB91-2.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013629516.10.0PREDICTED: transcription factor AS1-like
SwissprotO809310.0AS1_ARATH; Transcription factor AS1
TrEMBLA0A0D3B5G20.0A0A0D3B5G2_BRAOL; Uncharacterized protein
STRINGBra000011.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61862740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.11e-177MYB family protein